A1589
MYOC Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1589
- Zusätzliche Namen:
- GLC1A|GPOA|JOAG|JOAG1|MYOC|TIGR
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
- Uniprot:
- Q99972
- Synonyme:
- GLC1A;GPOA;JOAG;JOAG1;juvenile-onset open-angle glaucoma 1;mutated trabecular meshwork-induced glucocorticoid response protein;myocilin;myocilin 55 kDa subunit;myocilin trabecular meshwork inducible glucocorticoid response protein;TIGR;trabecular meshwork inducible glucocorticoid response protein;Trabecular meshwork-induced glucocorticoid response protein
- Weitere Details:
- MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma.
- Versandbedingungen:
- Blue Ice