CHRNA7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1588
Zusätzliche Namen:: CHRNA7|CHRNA7-2|NACHRA7
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASPPSTPPWDPGHIPGASVRPAPGPVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGI
Uniprot:: P36544
Synonyme:: a7 nicotinic acetylcholine receptor;alpha 7 neuronal nicotinic acetylcholine receptor;alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid;alpha-7 nicotinic cholinergic receptor subunit;cholinergic receptor, nicotinic alpha 7;cholinergic receptor, nicotinic, alpha 7 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 7;CHRNA7;CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion;CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion;CHRNA7-2;CHRNA7-DR1;CHRNA7-FAM7A fusion protein;D-10;NACHRA7;neuronal acetylcholine receptor protein, alpha-7 chain;neuronal acetylcholine receptor subunit alpha-7
Weitere Details:: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice