ATP10A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15873
Zusätzliche Namen:: ATP10A|ATP10C|ATPVA|ATPVC
Anwendung:: ELISA, WB
Molekulargewicht:: 170kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Uniprot:: O60312
Synonyme:: aminophospholipid translocase VA;ATP10C;ATPase class V type 10A;ATPase type IV, phospholipid transporting (P-type);ATPase, class V, type 10A;ATPase, Class V, type 10C;ATPVA;ATPVC;P4-ATPase flippase complex alpha subunit ATP10A;phospholipid-transporting ATPase VA;probable phospholipid-transporting ATPase VA
Weitere Details:: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'.

Versandbedingungen:: Blue Ice