UBQLN4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15869
Zusätzliche Namen:: A1U|A1Up|C1orf6|CIP75|UBIN|UBQLN4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFAAQMMVNVPLFAG
Uniprot:: Q9NRR5
Synonyme:: A1U;A1Up;ataxin-1 interacting ubiquitin-like protein;ataxin-1 ubiquitin-like interacting protein;ataxin-1 ubiquitin-like-interacting protein A1U;C1orf6;CIP75;connexin43-interacting protein of 75 kDa;UBIN;ubiquilin-4
Weitere Details:: Enables K48-linked polyubiquitin modification-dependent protein binding activity and identical protein binding activity. Involved in cellular response to DNA damage stimulus; negative regulation of double-strand break repair via homologous recombination; and regulation of cellular catabolic process. Located in several cellular components, including autophagosome; nucleoplasm; and site of DNA damage. Part of protein-containing complex. Colocalizes with cytosolic proteasome complex and nuclear proteasome complex.