MRPL51 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15838
Zusätzliche Namen:: bMRP64|CDA09|HSPC241|MRP64|MRPL51
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
Uniprot:: Q4U2R6
Synonyme:: 39S ribosomal protein L51, mitochondrial;bMRP-64;bMRP64;CDA09;HSPC241;L51mt;mitochondrial large ribosomal subunit protein mL51;mitochondrial ribosomal protein 64;mitochondrial ribosomal protein bMRP64;MRP-L51;MRP64
Weitere Details:: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q.

Versandbedingungen:: Blue Ice