A15822
MCAT Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15822
- Zusätzliche Namen:
- fabD|FASN2C|MCAT|MCT|MCT1|MT|NET62
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
- Uniprot:
- Q8IVS2
- Synonyme:
- [Acyl-carrier-protein] malonyltransferase;[acyl-carrier-protein] S-malonyltransferase;fabD;FASN2C;malonyl CoA:ACP acyltransferase (mitochondrial);malonyl-CoA-acyl carrier protein transacylase, mitochondrial;MCT;MCT1;mitochondrial malonyl CoA:ACP acyltransferase;mitochondrial malonyltransferase;MT;NET62
- Weitere Details:
- The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice

