KDM1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15794
Zusätzliche Namen:: AOF2|BHC110|CPRF|KDM1|LSD1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ
Uniprot:: O60341
Synonyme:: [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A;amine oxidase (flavin containing) domain 2;AOF2;BHC110;BRAF35-HDAC complex protein BHC110;CPRF;FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit;flavin-containing amine oxidase domain-containing protein 2;KDM1;LSD1;lysine (K)-specific demethylase 1A;lysine-specific histone demethylase 1;lysine-specific histone demethylase 1A
Weitere Details:: This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice