CHP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15791
Zusätzliche Namen:: CHP|CHP1|p22|p24|Sid470p|SLC9A1BP|SPAX9
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Uniprot:: Q99653
Synonyme:: calcineurin B homolog;calcineurin B homologous protein 1;calcineurin B-like protein;calcineurin homologous protein;calcium binding protein P22;calcium-binding protein CHP;calcium-binding protein p22;CHP;EF-hand calcium-binding domain-containing protein p22;p22;p24;Sid470p;SLC9A1 binding protein;SLC9A1BP;SPAX9
Weitere Details:: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.