[KO Validated] SEC61B Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A15788
Zusätzliche Namen:: 1B|SEC61B
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Uniprot:: P60468
Synonyme:: protein translocation complex beta;protein transport protein SEC61 beta subunit;protein transport protein Sec61 subunit beta;Sec61 beta subunit;Sec61 complex, beta subunit;SEC61 translocon beta subunit
Weitere Details:: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.