TENM1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15774
Zusätzliche Namen:: ODZ1|ODZ3|ten-1|TEN-M1|TEN1|TENM1|TNM|TNM1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 280kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
Uniprot:: Q9UKZ4
Synonyme:: odz (odd Oz/ten-m, Drosophila) homolog 3;odz, odd Oz/ten-m homolog 1(Drosophila);ODZ1;ODZ3;protein Odd Oz/ten-m homolog 1;ten-1;TEN-M1;TEN1;tenascin M1;Tenascin-M1;Teneurin transmembrane protein 1;teneurin-1;TNM;TNM1
Weitere Details:: The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.