Bim Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15771
Zusätzliche Namen:: BAM|BIM|BOD
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 18kDa/23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Uniprot:: O43521
Synonyme:: BAM;bcl-2 interacting mediator of cell death;bcl-2 interacting protein Bim;bcl-2-like protein 11;bcl-2-related ovarian death agonist;Bcl2-interacting mediator of cell death;BCL2-like 11 (apoptosis facilitator);BIM;BOD
Weitere Details:: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified.

Versandbedingungen:: Blue Ice