A15750
SKAP2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15750
- Zusätzliche Namen:
- PRAP|RA70|SAPS|SCAP2|SKAP-HOM|SKAP2|SKAP55R
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
- Uniprot:
- O75563
- Synonyme:
- Fyn-associated phosphoprotein SKAP55 homologue;PRAP;Pyk2/RAFTK-associated protein;RA70;retinoic acid-induced protein 70;SAPS;SCAP2;SKAP-55HOM;SKAP-HOM;SKAP55 homolog;SKAP55R;src family-associated phosphoprotein 2;src kinase-associated phosphoprotein 2;Src kinase-associated phosphoprotein 55-related protein;src kinase-associated phosphoprotein of 55-related protein;src-associated adapter protein with PH and SH3 domains
- Weitere Details:
- The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice