PPAP2B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15743
Zusätzliche Namen:: Dri42|LPP3|PAP2B|PPAP2B|VCIP
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Uniprot:: O14495
Synonyme:: Dri42;lipid phosphate phosphohydrolase 3;LPP3;PAP2 beta;PAP2-beta;PAP2B;phosphatidate phosphohydrolase type 2b;Phosphatidic acid phosphatase 2b;phosphatidic acid phosphatase type 2B;phospholipid phosphatase 3;PPAP2B;type-2 phosphatidic acid phosphatase-beta;vascular endothelial growth factor and type I collagen inducible;Vascular endothelial growth factor and type I collagen-inducible protein;VCIP
Weitere Details:: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.

Versandbedingungen:: Blue Ice