A15740
KDM5C Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15740
- Zusätzliche Namen:
- DXS1272E|JARID1C|KDM5C|MRX13|MRXJ|MRXSCJ|MRXSJ|SMCX|XE169
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 180 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
- Uniprot:
- P41229
- Synonyme:
- [histone H3]-trimethyl-L-lysine(4) demethylase 5C;DXS1272E;histone demethylase JARID1C;JARID1C;JmjC domain-containing protein SMCX;Jumonji, AT rich interactive domain 1C (RBP2-like);Jumonji/ARID domain-containing protein 1C;lysine (K)-specific demethylase 5C;lysine-specific demethylase 5C;MRX13;MRXJ;MRXSCJ;MRXSJ;Protein SmcX;Protein Xe169;SMCX;Smcx homolog, X chromosome;Smcy homolog, X-linked;XE169
- Weitere Details:
- This gene is a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. The DNA-binding motifs suggest this protein is involved in the regulation of transcription and chromatin remodeling. Mutations in this gene have been associated with X-linked cognitive disability. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

_WB_01.jpg)