SUMO3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15724
Zusätzliche Namen:: SMT3A|Smt3B|SMT3H1|SUMO-3|SUMO3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 17-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Uniprot:: P55854
Synonyme:: small ubiquitin-related modifier 3;SMT3 homolog 1;SMT3 suppressor of mif two 3 homolog 1;SMT3 suppressor of mif two 3 homolog 3;SMT3A;Smt3B;SMT3H1;SUMO-2;SUMO-3;Ubiquitin-like protein SMT3A;ubiquitin-like protein SMT3B
Weitere Details:: This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described.