A15707
PP2A-B56D Delta/PR61D Delta/PPP2R5D Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15707
- Zusätzliche Namen:
- B56D|B56delta|MRD35|PP2A-B56D Delta/PR61D Delta/PPP2R5D
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT
- Uniprot:
- Q14738
- Synonyme:
- B56D;B56delta;MRD35;PP2A B subunit isoform B'-delta;PP2A B subunit isoform B56-delta;PP2A B subunit isoform PR61-delta;PP2A B subunit isoform R5-delta;serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
- Weitere Details:
- The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice