A15704
PLC gamma 1 (PLCG1) Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15704
- Zusätzliche Namen:
- NCKAP3|PLC gamma 1 (PLCG1)|PLC-II|PLC1|PLC148|PLCgamma1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 149kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
- Uniprot:
- P19174
- Synonyme:
- 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate;1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1;inositoltrisphosphohydrolase;monophosphatidylinositol phosphodiesterase;NCKAP3;phosphatidylinositol phospholipase C;phosphoinositidase C;phosphoinositide phospholipase C;phosphoinositide phospholipase C-gamma-1;phospholipase C-148;Phospholipase C-gamma-1;phospholipase C-II;phospholipase C, gamma 1 (formerly subtype 148);PLC-148;PLC-gamma-1;PLC-II;PLC1;PLC148;PLCgamma1;triphosphoinositide phosphodiesterase
- Weitere Details:
- The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



