SERPINI1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15703
Zusätzliche Namen:: HNS-S1|HNS-S2|neuroserpin|PI12|SERPINI1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Uniprot:: Q99574
Synonyme:: HNS-S1;HNS-S2;neuroserpin;peptidase inhibitor 12;PI-12;PI12;serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1;serpin I1;serpin peptidase inhibitor clade I member 1;serpin peptidase inhibitor, clade I (neuroserpin), member 1;truncated HNS-T
Weitere Details:: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Versandbedingungen:: Blue Ice