A1569
TPH1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1569
- Zusätzliche Namen:
- TPH1|TPRH|TRPH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 51kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
- Uniprot:
- P17752
- Synonyme:
- indoleacetic acid-5-hydroxylase;L-tryptophan hydroxylase;TPRH;TRPH;tryptophan 5-hydroxylase 1;tryptophan 5-monooxygenase 1;tryptophan hydroxylase (tryptophan 5-monooxygenase)
- Weitere Details:
- This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others.
- Versandbedingungen:
- Blue Ice