A15687
LTBP3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15687
- Zusätzliche Namen:
- DASS|GPHYSD3|LTBP-3|LTBP2|LTBP3|pp6425|STHAG6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 139kDa/260kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
- Uniprot:
- Q9NS15
- Synonyme:
- DASS;GPHYSD3;latent TGF beta binding protein 3;latent-transforming growth factor beta-binding protein 3;LTBP-3;LTBP2;pp6425;STHAG6
- Weitere Details:
- The protein encoded by this gene forms a complex with transforming growth factor beta (TGF-beta) proteins and may be involved in their subcellular localization. Activation of this complex requires removal of the encoded binding protein. This protein also may play a structural role in the extracellular matrix. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice