A15686
HSL Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15686
- Zusätzliche Namen:
- AOMS4|FPLD6|HSL|LHS|REH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 84kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
- Uniprot:
- Q05469
- Synonyme:
- AOMS4;FPLD6;hormone-sensitive lipase;HSL;LHS;lipase, hormone-sensitive;monoacylglycerol lipase LIPE;REH;retinyl ester hydrolase
- Weitere Details:
- The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
- Versandbedingungen:
- Blue Ice