KCNS2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15684
Zusätzliche Namen:: KCNS2|KV9.2
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSR
Uniprot:: Q9ULS6
Synonyme:: delayed-rectifier K(+) channel alpha subunit 2;KV9.2;potassium voltage-gated channel subfamily S member 2;potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2;voltage-gated potassium channel subunit Kv9.2
Weitere Details:: Predicted to enable voltage-gated potassium channel activity. Predicted to be involved in potassium ion transmembrane transport and regulation of delayed rectifier potassium channel activity. Predicted to be located in perinuclear region of cytoplasm and plasma membrane. Predicted to be part of voltage-gated potassium channel complex. Predicted to be integral component of membrane.