Monoamine Oxidase B (MAOB) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1568
Zusätzliche Namen:: MAOB|Monoamine Oxidase B (MAOB)
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP
Uniprot:: P27338
Synonyme:: adrenalin oxidase;amine oxidase [flavin-containing] B;MAO-B;MAO, brain;MAO, platelet;monoamine oxidase type B;tyramine oxidase
Weitere Details:: The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.