A15666
ETS1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15666
- Zusätzliche Namen:
- c-ets-1|ETS-1|ETS1|EWSR2|p54
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
- Uniprot:
- P14921
- Synonyme:
- Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1;c-ets-1;ETS-1;EWSR2;p54;protein C-ets-1;v-ets avian erythroblastosis virus E2 oncogene homolog 1;v-ets avian erythroblastosis virus E26 oncogene homolog 1
- Weitere Details:
- This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice





