RNF149 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15627
Zusätzliche Namen:: DNAPTP2|RNF149
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: FYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS
Uniprot:: Q8NC42
Synonyme:: DNA polymerase-transactivated protein 2;DNAPTP2;E3 ubiquitin-protein ligase RNF149;RING finger protein 149;RING-type E3 ubiquitin transferase RNF149
Weitere Details:: Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to xenobiotic stimulus; negative regulation of MAPK cascade; and regulation of protein stability. Located in membrane.