IMPDH2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15626
Zusätzliche Namen:: IMPD2|IMPDH-II|IMPDH2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 56kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Uniprot:: P12268
Synonyme:: epididymis secretory sperm binding protein;IMP (inosine 5'-monophosphate) dehydrogenase 2;IMP (inosine monophosphate) dehydrogenase 2;IMP dehydrogenase II;IMP oxireductase 2;IMPD 2;IMPD2;IMPDH 2;IMPDH-II;inosine 5' phosphate dehydrogenase 2;inosine monophosphate dehydrogenase type II;inosine-5'-monophosphate dehydrogenase 2;inosine-5'-monophosphate dehydrogenase type II
Weitere Details:: This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Versandbedingungen:: Blue Ice