A15618
TrkA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15618
- Zusätzliche Namen:
- MTC|p140-TrkA|TRK|Trk-A|TRK1|TRKA
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
- Uniprot:
- P04629
- Synonyme:
- gp140trk;high affinity nerve growth factor receptor;MTC;Neurotrophic tyrosine kinase receptor type 1;neurotrophic tyrosine kinase, receptor, type 1;Oncogene TRK;p140-TrkA;TRK;Trk-A;TRK1;TRK1-transforming tyrosine kinase protein;TRKA;tropomyosin-related kinase A;Tyrosine kinase receptor;tyrosine kinase receptor A
- Weitere Details:
- This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
- Versandbedingungen:
- Blue Ice







