A15617
NDUFB11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15617
- Zusätzliche Namen:
- CI-ESSS|ESSS|MC1DN30|NDUFB11|Np15|NP17.3|P17.3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
- Uniprot:
- Q9NX14
- Synonyme:
- CI-ESSS;complex I NP17.3 subunit;complex I-ESSS;ESSS;MC1DN30;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial;NADH-ubiquinone oxidoreductase ESSS subunit;neuronal protein 17.3;Np15;NP17.3;P17.3
- Weitere Details:
- The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency.
- Versandbedingungen:
- Blue Ice

