PDE10A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15597
Zusätzliche Namen:: ADSD2|HSPDE10A|IOLOD|LINC00473|PDE10A|PDE10A19
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 88kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLC
Uniprot:: Q9Y233
Synonyme:: 3',5' cAMP/cGMP phosphodiesterase;ADSD2;cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A;dJ416F21.1 (phosphodiesterase 10A);HSPDE10A;IOLOD;LINC00473;PDE10A19;phosphodiesterase 10A1 (PDE10A1);phosphodiesterase 10A7 (PDE10A7)
Weitere Details:: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase family. It plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This protein can hydrolyze both cAMP and cGMP to the corresponding nucleoside 5' monophosphate, but has higher affinity for cAMP, and is more efficient with cAMP as substrate. Alternatively spliced transcript variants have been described for this gene.