A15557
SLC25A26 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15557
- Zusätzliche Namen:
- COXPD28|SAMC|SLC25A26
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVC
- Uniprot:
- Q70HW3
- Synonyme:
- COXPD28;mitochondrial S-adenosylmethionine transporter;S-adenosylmethionine mitochondrial carrier protein;SAMC;solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 26;solute carrier family 25 (S-adenosylmethionine carrier), member 26;Solute carrier family 25 member 26
- Weitere Details:
- This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This protein is involved in the transport of S-adenosylmethionine (SAM) into the mitochondria. Mutations in this gene are associated with combined oxidative phosphorylation deficiency 28. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice