DNER Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15551
Zusätzliche Namen:: bet|DNER|UNQ26
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
Uniprot:: Q8NFT8
Synonyme:: bet;delta and Notch-like epidermal growth factor-related receptor;delta-notch-like EGF repeat-containing transmembrane;H_NH0150O02.1;UNQ26;WUGSC:H_NH0150O02.1
Weitere Details:: Predicted to enable Notch binding activity. Involved in central nervous system development. Located in dendrite; early endosome; and plasma membrane.