A15544
TPD52L3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15544
- Zusätzliche Namen:
- D55|hD55|NYDSP25|TPD52L3|TPD55
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 13kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
- Uniprot:
- Q96J77
- Synonyme:
- D55;hD55;NYDSP25;protein kinase NYD-SP25;testis development protein NYD-SP25;testis tissue sperm-binding protein Li 87P;TPD55;tumor protein D52 like 3;Tumor protein D52-like 3;tumor protein D55
- Weitere Details:
- This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice