HOPX Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A15537PM
Zusätzliche Namen:: CAMEO|HOD|HOP|LAGY|NECC1|OB1|SMAP31|TOTO
Anwendung:: ELISA, WB, IHC-P, IF, IP
Molekulargewicht:: 15 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Uniprot:: Q9BPY8
Synonyme:: CAMEO;HOD;homeodomain-only protein;HOP;LAGY;lung cancer-associated Y protein;NECC1;not expressed in choriocarcinoma clone 1;Not expressed in choriocarcinoma protein 1;OB1;odd homeobox protein 1;SMAP31;TOTO
Weitere Details:: The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene.