KCNH6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15522
Zusätzliche Namen:: ERG-2|ERG2|hERG-2|HERG2|KCNH6|Kv11.2
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVT
Uniprot:: Q9H252
Synonyme:: eag-related gene member 2;ERG-2;ERG2;Ether-a-go-go-related gene potassium channel 2;ether-a-go-go-related protein 2;hERG-2;HERG2;Kv11.2;potassium channel, voltage gated eag related subfamily H, member 6;potassium voltage-gated channel subfamily H member 6;potassium voltage-gated channel, subfamily H (eag-related), member 6;voltage-gated potassium channel subunit Kv11.2
Weitere Details:: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Alternative splicing results in multiple transcript variants that encode different isoforms.

Versandbedingungen:: Blue Ice