A15519
DCAF11 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15519
- Zusätzliche Namen:
- DCAF11|GL014|PRO2389|WDR23
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- ABP:
- No Import Docs
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRERGLCHRGSFSLGEQSRVISHFLPNDLGFTDS
- Uniprot:
- Q8TEB1
- Synonyme:
- DDB1- and CUL4-associated factor 11;GL014;PRO2389;WD repeat domain 23;WD repeat-containing protein 23;WDR23
- Weitere Details:
- This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice