A15506
RAPH1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15506
- Zusätzliche Namen:
- ALS2CR18|ALS2CR9|LPD|PREL-2|PREL2|RalGDS/AF-6|RAPH1|RMO1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 200kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
- Uniprot:
- Q70E73
- Synonyme:
- ALS2CR18;ALS2CR9;amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 18;amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 9;Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein;Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein;lamellipodin;LPD;PREL-2;PREL2;proline-rich EVH1 ligand 2;Protein RMO1;RalGDS/AF-6;ras-associated and pleckstrin homology domains-containing protein 1;RMO1
- Weitere Details:
- This gene encodes a protein that belongs to the Mig10/Rap1-interacting adaptor molecule/Lamellipodin family of adapter proteins, which function in cell migration. Members of this family contain pleckstrin-homology domains, Ras-association domains, and proline-rich C-termini. The protein encoded by this gene regulates actin dynamics through interaction with Ena/Vasodilator proteins as well as direct binding to filamentous actin to regulate actin network assembly. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice