A15500
NECAB3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15500
- Zusätzliche Namen:
- APBA2BP|dJ63M2.4|dJ63M2.5|EFCBP3|NECAB3|NIP1|STIP3|SYTIP2|XB51
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
- Uniprot:
- Q96P71
- Synonyme:
- amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein;amyloid beta A4 protein-binding family A member 2-binding protein;Amyloid-beta A4 protein-binding family A member 2-binding protein;APBA2BP;dJ63M2.4;dJ63M2.5;EF-hand calcium binding protein 3;EFCBP3;N-terminal EF-hand calcium-binding protein 3;Nek2-interacting protein 1;neuronal calcium-binding protein 3;neuronal calcium-binding protein NECAB3;NIP1;STIP3;synaptotagmin interacting protein 2;synaptotagmin interacting protein STIP3;SYTIP2;X11L-binding protein 51;XB51
- Weitere Details:
- The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

