ARID1B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15488
Zusätzliche Namen:: 6A3-5|ARID1B|BAF250B|BRIGHT|CSS1|DAN15|ELD/OSA1|MRD12|OSA2|P250R|SMARCF2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPN
Uniprot:: Q8NFD5
Synonyme:: 6A3-5;ARID domain-containing protein 1B;AT rich interactive domain 1B (SWI1-like);AT-rich interactive domain-containing protein 1B;BAF250B;BRG1-associated factor 250b;BRG1-binding protein ELD/OSA1;BRG1-binding protein hELD/OSA1;BRIGHT;CSS1;DAN15;ELD (eyelid)/OSA protein;ELD/OSA1;MRD12;Osa homolog 2;OSA2;P250R;SMARCF2
Weitere Details:: This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice