CDK5RAP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15476
Zusätzliche Namen:: C48|CDK5RAP2|Cep215|MCPH3
Anwendung:: ELISA, WB
Molekulargewicht:: 250kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS
Uniprot:: Q96SN8
Synonyme:: C48;CDK5 activator-binding protein C48;CDK5 regulatory subunit-associated protein 2;centrosomal protein 215 kDa;Centrosome-associated protein 215;centrosomin;Cep215;MCPH3
Weitere Details:: This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.