A15470
ZNF331 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15470
- Zusätzliche Namen:
- RITA|ZNF331|ZNF361|ZNF463
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
- Uniprot:
- Q9NQX6
- Synonyme:
- C2H2-like zinc finger protein rearranged in thyroid adenomas;KRAB zinc finger protein;RITA;zinc finger protein 331;zinc finger protein 361;zinc finger protein 463;ZNF361;ZNF463
- Weitere Details:
- This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.
- Versandbedingungen:
- Blue Ice