[KO Validated] GIT1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A15437
Zusätzliche Namen:: p95-APP1|T1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP
Uniprot:: Q9Y2X7
Synonyme:: ARF GAP GIT1;ARF GTPase-activating protein GIT1;CAT-1;CAT1;cool-associated and tyrosine-phosphorylated protein 1;G protein-coupled receptor kinase interacting ArfGAP 1;G protein-coupled receptor kinase-interactor 1;GRK-interacting protein 1;p95-APP1
Weitere Details:: Enables gamma-tubulin binding activity. Involved in positive regulation of microtubule nucleation and regulation of cytokinesis. Located in several cellular components, including focal adhesion; microtubule cytoskeleton; and mitochondrion. Implicated in attention deficit hyperactivity disorder. Biomarker of Huntington's disease.