SULT1C4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15433
Zusätzliche Namen:: SULT1C|SULT1C2|SULT1C4
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS
Uniprot:: O75897
Synonyme:: ST1C4;sulfotransferase 1C2;sulfotransferase 1C4;sulfotransferase family, cytosolic, 1C, member 2;sulfotransferase family, cytosolic, 1C, member 4;sulfotransferase family, cytosolic, 1C, member C2;SULT1C;SULT1C#2;SULT1C2
Weitere Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.