A15420
KANK2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15420
- Zusätzliche Namen:
- ANKRD25|KANK2|MXRA3|NPHS16|PPKWH|SIP
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- ABP:
- No Import Docs
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPTAGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
- Uniprot:
- Q63ZY3
- Synonyme:
- ANKRD25;ankyrin repeat domain-containing protein 25;kidney ankyrin repeat-containing protein 2;KN motif and ankyrin repeat domain-containing protein 2;matrix-remodeling-associated protein 3;MXRA3;NPHS16;PPKWH;SIP;SRC-1-interacting protein;SRC-interacting protein;SRC1-interacting protein
- Weitere Details:
- This gene encodes a member of the KN motif and ankyrin repeat domains (KANK) family of proteins, which play a role in cytoskeletal formation by regulating actin polymerization. The encoded protein functions in the sequestration of steroid receptor coactivators and possibly other proteins. Mutations in this gene are associated with impaired kidney podocyte function and nephrotic syndrome, and keratoderma and woolly hair.
- Versandbedingungen:
- Blue Ice





