CRTC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15412
Zusätzliche Namen:: CRTC1|Mam-2|MAML2|MECT1|TORC-1|TORC1|WAMTP1
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLS
Uniprot:: Q6UUV9
Synonyme:: CREB-regulated transcription coactivator 1;Mam-2;MAML2;Mastermind-like protein 2;MECT1;mucoepidermoid carcinoma translocated protein 1;TORC-1;TORC1;transducer of regulated cAMP response element-binding protein (CREB) 1;Transducer of regulated cAMP response element-binding protein 1;WAMTP1
Weitere Details:: Enables cAMP response element binding protein binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in cytosol; nuclear body; and plasma membrane.