A15382
TCIRG1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15382
- Zusätzliche Namen:
- a3|Atp6i|ATP6N1C|ATP6V0A3|OC-116kDa|OC116|OPTB1|Stv1|TCIRG1|TIRC7|Vph1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 110 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAA
- Uniprot:
- Q13488
- Synonyme:
- a3;Atp6i;ATP6N1C;ATP6V0A3;ATPase, H+ transporting, 116kD;OC-116kDa;OC116;OPTB1;osteoclastic proton pump 116 kDa subunit;specific 116-kDa vacuolar proton pump subunit;Stv1;T-cell immune regulator 1;T-cell immune response cDNA 7;T-cell immune response cDNA7 protein;T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a;T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3;TIRC7;V-ATPase 116 kDa subunit a3;V-ATPase 116-kDa;V-ATPase subunit a3;V-type proton ATPase 116 kDa subunit a;V-type proton ATPase 116 kDa subunit a3;vacuolar proton translocating ATPase 116 kDa subunit A;Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3;Vph1
- Weitere Details:
- This gene encodes a subunit of a large protein complex known as a vacuolar H+-ATPase (V-ATPase). The protein complex acts as a pump to move protons across the membrane. This movement of protons helps regulate the pH of cells and their surrounding environment. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Alternative splicing results in multiple transcript variants. Mutations in this gene are associated with infantile malignant osteopetrosis.
- Versandbedingungen:
- Blue Ice








