FIG4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15372
Zusätzliche Namen:: ALS11|BOP|BTOP|CMT4J|dJ249I4.1|FIG4|KIAA0274|SAC3|YVS
Anwendung:: ELISA, WB
Molekulargewicht:: 104kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL
Uniprot:: Q92562
Synonyme:: ALS11;BTOP;CMT4J;dJ249I4.1;FIG4 homolog, SAC domain containing lipid phosphatase;FIG4 homolog, SAC1 domain containing lipid phosphatase;FIG4 homolog, SAC1 lipid phosphatase domain containing;KIAA0274;phosphatidylinositol 3,5-bisphosphate 5-phosphatase;polyphosphoinositide phosphatase;Sac domain-containing inositol phosphatase 3;SAC domain-containing protein 3;SAC3;YVS
Weitere Details:: The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J.

Versandbedingungen:: Blue Ice