A15368
GIT2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15368
- Zusätzliche Namen:
- CAT-2|CAT2|GIT2|PKL
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 84kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP
- Uniprot:
- Q14161
- Synonyme:
- ARF GAP GIT2;ARF GTPase-activating protein GIT2;CAT-2;CAT2;cool-associated, tyrosine phosphorylated protein 2;cool-interacting tyrosine-phosphorylated protein 2;G protein-coupled receptor kinase interacting ArfGAP 2;G protein-coupled receptor kinase-interactor 2;GRK-interacting protein 2;Paxillin kinase linker;PKL
- Weitere Details:
- This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.
- Versandbedingungen:
- Blue Ice

