A15351
CYTH1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15351
- Zusätzliche Namen:
- B2-1|CYTH1|CYTOHESIN-1|D17S811E|PSCD1|SEC7
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR
- Uniprot:
- Q15438
- Synonyme:
- B2-1;cytoadhesin 1;cytohesin-1;D17S811E;homolog of secretory protein SEC7;PH, SEC7 and coiled-coil domain-containing protein 1;pleckstrin homology, Sec7 and coiled-coil domains 1;PSCD1;SEC7;SEC7 homolog B2-1
- Weitere Details:
- The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice