ZSCAN21 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15330
Zusätzliche Namen:: NY-REN-21|Zipro1|ZNF38|ZSCAN21
Anwendung:: ELISA, WB
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICA
Uniprot:: Q9Y5A6
Synonyme:: NY-REN-21;renal carcinoma antigen NY-REN-21;zfp-38;zinc finger and SCAN domain-containing protein 21;zinc finger protein 38 (KOX 25);zinc finger protein 38 homolog;zinc finger protein NY-REN-21 antigen;Zipro1;ZNF38
Weitere Details:: Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.