RNASE6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15312
Zusätzliche Namen:: RAD1|RNASE6|RNasek6|RNS6
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
Uniprot:: Q93091
Synonyme:: RAD1;ribonuclease A D1;ribonuclease K6;ribonuclease, RNase A family, k6;RNasek6;RNS6;testicular tissue protein Li 166
Weitere Details:: The protein encoded by this gene is a member of the ribonuclease A superfamily and functions in the urinary tract. The protein has broad-spectrum antimicrobial activity against pathogenic bacteria.